PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G24690.1
Common NameF25P17.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 777aa    MW: 87156.3 Da    PI: 7.7068
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G24690.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99.1e-2498190297
                  EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  ++ ++ +  ++++rl+lp +f++e+g++k++  ++ l  ++g +W  +l  ++++gr++l++GWk+FvkangLk+gD+ +Fkl + +++++v++++
  AT2G24690.1  98 VTFTLAPVDGRHCRLRLPMQFTRENGINKPG--KIYLVGKDGSKWLANLLLENNRGRMTLGDGWKSFVKANGLKTGDTYTFKLLW-EDTTPVLSLC 190
                  55666777899***************99776..7**************************************************9.8888998887 PP

2B367.71.6e-21254345398
                  EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  +v++++d+l++grl+lp +f++e++++k++  ++tl  ++g +W   l    k+gr+ l+kGWk+F+kangLk+gD+++++ ++ +++++v+++ +
  AT2G24690.1 254 TVTITPDSLEHGRLRLPLQFMTENSMNKPG--EITLLGTDGAKWMASLLL-EKKGRMSLGKGWKDFAKANGLKTGDSITLEPIW-EDRTPVLSIKS 345
                  67899*******************999766..8***************65.5556789************************99.78889988865 PP

3B344.82.2e-14687773595
                  -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
           B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                  ++ +   k g+l lp +f++ +g++k++  ++tl  + g +W  +l    ++g++v ++GWk+F++ang+  g+++v++++ +++++ v+k
  AT2G24690.1 687 TLAPEDVKDGNLHLPCQFMRINGINKPG--QITLLGRGGMKWFAYL--LSGDGTVVVGNGWKGFCEANGVMLGETFVLEFIPKDDTNHVFK 773
                  44455556666********999999877..6***************..99*****************************996666655665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.2E-2391190IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.42E-2493194IPR015300DNA-binding pseudobarrel domain
CDDcd100171.03E-2195190No hitNo description
PROSITE profilePS5086315.97597193IPR003340B3 DNA binding domain
SMARTSM010199.5E-3397193IPR003340B3 DNA binding domain
PfamPF023625.2E-2397190IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-20246346IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.46E-22247345IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.917252347IPR003340B3 DNA binding domain
SMARTSM010194.2E-31252347IPR003340B3 DNA binding domain
CDDcd100177.61E-18253343No hitNo description
PfamPF023624.7E-21253345IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-8576637IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.5E-8576639IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508636.358582676IPR003340B3 DNA binding domain
SMARTSM010191.1E-9582676IPR003340B3 DNA binding domain
PfamPF023622.1E-7582637IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.8E-17676774IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.02E-20677774IPR015300DNA-binding pseudobarrel domain
CDDcd100173.53E-12682775No hitNo description
PROSITE profilePS5086313.422683777IPR003340B3 DNA binding domain
SMARTSM010195.7E-17683776IPR003340B3 DNA binding domain
PfamPF023621.3E-13683774IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MANSLILGSP INPEGEMMIQ FSNNHDNNIE FQRRKKMKKN NPETETDSSS DLSCFVAQTG  60
ALLHLPQGFT SSNGSNRECR KSPRPIISSY SSSEKQFVTF TLAPVDGRHC RLRLPMQFTR  120
ENGINKPGKI YLVGKDGSKW LANLLLENNR GRMTLGDGWK SFVKANGLKT GDTYTFKLLW  180
EDTTPVLSLC FEEYNTDTRV GEESSKESLP AEPSSQEKIV KDDNNKDESS TWKREGNHLR  240
CKDSTSPSQN CTLTVTITPD SLEHGRLRLP LQFMTENSMN KPGEITLLGT DGAKWMASLL  300
LEKKGRMSLG KGWKDFAKAN GLKTGDSITL EPIWEDRTPV LSIKSSSGKG QSEFSKESLS  360
IKPSSGNMTK KVENNREASR KYPPRSRESS SAIQNQFMAL TPLRDIVSQV AHDLSIGEVI  420
NFRHKGDNML RVSDLGSNCC GVQDLLAPSS NYDHDNISNI SMKINPHIRK EAVTFSSYDG  480
YAHDNFEPPS KKKVKKNNPE MEADYLSDHS CFVSHVTTSS LHTNALSLEV KESLPIEPSI  540
KPNISEDDNN KEEDIIEENS SFEREKNHWI CIDSISSSQN RFLTLTITPD SLKHGRLRLP  600
LQFMIENSMN KPGEITVLGK DGAKWLVSLL LERRGRMSLD ASSGQETREA EKNREESSSL  660
WELEKRTYCP RKRDSSSDVK NRFLTLTLAP EDVKDGNLHL PCQFMRINGI NKPGQITLLG  720
RGGMKWFAYL LSGDGTVVVG NGWKGFCEAN GVMLGETFVL EFIPKDDTNH VFKFYTK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13138QRRKKMKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.391190.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341844320.0
Expression AtlasAT2G24690-
AtGenExpressAT2G24690-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G24690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G24690
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0069540.0AC006954.8 Arabidopsis thaliana chromosome 2 clone F25P17 map mi238, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180045.50.0transcriptional factor B3 family protein
SwissprotQ8S8E80.0REML1_ARATH; B3 domain-containing protein REM-like 1
TrEMBLD7LIB50.0D7LIB5_ARALL; Transcriptional factor B3 family protein
STRINGAT2G24690.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150791619
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  2. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]